(data stored in ACNUC1104 zone)

EMBL: AP008957.PE59

AP008957.PE59        Location/Qualifiers
FT   CDS             73347..74966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00590"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00590"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30767"
FT                   /db_xref="GOA:C0ZLJ9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLJ9"
FT                   /protein_id="BAH30767.1"
FT                   /translation="MSRSSRRGHRKVAAVALAVSAGLFVSSCADSGNGGGSGDAPDSGS
FT                   GLSIGPVNEQSGEGDAVKGGTLTFSGYSAVTNLDPAKTQIAGSVAGSELGAIYDTLLRY
FT                   DPASKEFVPKLAESMEPSSDFKTWTLELRDGVKFSDGTPVDSAAVSASLNRYVTNKGPQ
FT                   SSLYASKVASVDTPDASTVVFNLVDPWTGIESLLSTGPGMIVAPSAQQGDQFTPIGAGA
FT                   FTLEKFAPNEELILDAREDYFDGAPNVDKLRLISIVGSQSTTESLKSGGTDVAYMRSLP
FT                   NVLDLIDSGYPGFVDIPSLSYLSLVNTAPGRPGADVRVRQALALATDPVALDNRLNEGK
FT                   GLPGQVIFQDTSRWHNDVAPIGVDTAKAKQLLDEAKADGFDGKITYLTLQENSAQAMAL
FT                   ALQSMANAVGFDFQIEYVNSVADVVKRLYADRDFDMATGSANLAEADPFERLYSNLKTG
FT                   GRNNAASFSDPEMDTLLDQLGVATSNDAKIEVLAKIQERANEVVPWQVYGNTPWLGVWG
FT                   QNVHGIQQSLDGIMFFDKAWKN"
     MSRSSRRGHR KVAAVALAVS AGLFVSSCAD SGNGGGSGDA PDSGSGLSIG PVNEQSGEGD        60
     AVKGGTLTFS GYSAVTNLDP AKTQIAGSVA GSELGAIYDT LLRYDPASKE FVPKLAESME       120
     PSSDFKTWTL ELRDGVKFSD GTPVDSAAVS ASLNRYVTNK GPQSSLYASK VASVDTPDAS       180
     TVVFNLVDPW TGIESLLSTG PGMIVAPSAQ QGDQFTPIGA GAFTLEKFAP NEELILDARE       240
     DYFDGAPNVD KLRLISIVGS QSTTESLKSG GTDVAYMRSL PNVLDLIDSG YPGFVDIPSL       300
     SYLSLVNTAP GRPGADVRVR QALALATDPV ALDNRLNEGK GLPGQVIFQD TSRWHNDVAP       360
     IGVDTAKAKQ LLDEAKADGF DGKITYLTLQ ENSAQAMALA LQSMANAVGF DFQIEYVNSV       420
     ADVVKRLYAD RDFDMATGSA NLAEADPFER LYSNLKTGGR NNAASFSDPE MDTLLDQLGV       480
     ATSNDAKIEV LAKIQERANE VVPWQVYGNT PWLGVWGQNV HGIQQSLDGI MFFDKAWKN        539
//

If you have problems or comments...

PBIL Back to PBIL home page