(data stored in ACNUC1104 zone)

EMBL: AP008957.PE592

AP008957.PE592       Location/Qualifiers
FT   CDS             complement(669383..669859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31300"
FT                   /db_xref="GOA:C0ZNP8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNP8"
FT                   /protein_id="BAH31300.1"
FT                   /translation="MNEIVIERATDEDAAEILVLQRCCWVSEAISNNSMDIPPLHEDLP
FT                   TVRAWVQESTVWTARRGGRLVGAVRGTADGTAWQIGRLMVAPDLAGNGLGRRLLQHVEQ
FT                   NAPEHTTSFELFTGSKSVRNIRVYTRAGYSQLPPDPSHIPGVVYLSKPNAINSE"
     MNEIVIERAT DEDAAEILVL QRCCWVSEAI SNNSMDIPPL HEDLPTVRAW VQESTVWTAR        60
     RGGRLVGAVR GTADGTAWQI GRLMVAPDLA GNGLGRRLLQ HVEQNAPEHT TSFELFTGSK       120
     SVRNIRVYTR AGYSQLPPDP SHIPGVVYLS KPNAINSE                               158
//

If you have problems or comments...

PBIL Back to PBIL home page