(data stored in ACNUC1104 zone)

EMBL: AP008957.PE594

AP008957.PE594       Location/Qualifiers
FT   CDS             complement(672085..673206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05940"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05940"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31302"
FT                   /db_xref="GOA:C0ZNQ0"
FT                   /db_xref="InterPro:IPR007427"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ0"
FT                   /protein_id="BAH31302.1"
FT                   /translation="MVLRIFGLSIAISIIAMIVAFIYGGPEALFLVIILSILEISLSFD
FT                   NAVINATVLRRMSDFWQKIFLTIGIVIAVFGMRLVFPLVIVWAASGLGPVAALDLALNP
FT                   PADDAAYFANGEPSYETILTDAHPQIAAFGGMFLLMLFLGFIFEEREITWLSWLEKPLA
FT                   RIGKLDQLSVVVAGIVLVLSGSFLAADDKVSTVMISGVLGMITYIAVNGLGELFNLPEE
FT                   GEEEETTKSGGPTEFAKATGKAGFFLFLYLEVLDASFSFDGVIGAFAITADPIIIALGL
FT                   GFVGAMFVRSITVFLVRKGTLSDYVYLEHGAHWAIGALAVILMVSIGVHINEIITGLVG
FT                   VFLIGAAFISSLIRNKRIANADPKLDENTPATV"
     MVLRIFGLSI AISIIAMIVA FIYGGPEALF LVIILSILEI SLSFDNAVIN ATVLRRMSDF        60
     WQKIFLTIGI VIAVFGMRLV FPLVIVWAAS GLGPVAALDL ALNPPADDAA YFANGEPSYE       120
     TILTDAHPQI AAFGGMFLLM LFLGFIFEER EITWLSWLEK PLARIGKLDQ LSVVVAGIVL       180
     VLSGSFLAAD DKVSTVMISG VLGMITYIAV NGLGELFNLP EEGEEEETTK SGGPTEFAKA       240
     TGKAGFFLFL YLEVLDASFS FDGVIGAFAI TADPIIIALG LGFVGAMFVR SITVFLVRKG       300
     TLSDYVYLEH GAHWAIGALA VILMVSIGVH INEIITGLVG VFLIGAAFIS SLIRNKRIAN       360
     ADPKLDENTP ATV                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page