(data stored in ACNUC1104 zone)

EMBL: AP008957.PE595

AP008957.PE595       Location/Qualifiers
FT   CDS             complement(673344..673919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05950"
FT                   /product="putative tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05950"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31303"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ1"
FT                   /protein_id="BAH31303.1"
FT                   /translation="MGVSLTKGGNVSLTKEAPNLTAVVVGLGWDARSTTGAAFDLDASA
FT                   IGAGSNKKVLSDQHFIFFNNLRSPDGSIEHKGDNTDGEGEGDDEQIDVNLAAVPAEIES
FT                   VVFPVSIYDAEARSQSFGQVRNAYIRVVDKANGNELARYDLSEDASTETAMVFGELYRN
FT                   GAEWKFRAIGQGYASGLSGIARDYGVNV"
     MGVSLTKGGN VSLTKEAPNL TAVVVGLGWD ARSTTGAAFD LDASAIGAGS NKKVLSDQHF        60
     IFFNNLRSPD GSIEHKGDNT DGEGEGDDEQ IDVNLAAVPA EIESVVFPVS IYDAEARSQS       120
     FGQVRNAYIR VVDKANGNEL ARYDLSEDAS TETAMVFGEL YRNGAEWKFR AIGQGYASGL       180
     SGIARDYGVN V                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page