(data stored in ACNUC1104 zone)

EMBL: AP008957.PE599

AP008957.PE599       Location/Qualifiers
FT   CDS             677841..678950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_05990"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_05990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31307"
FT                   /db_xref="InterPro:IPR011215"
FT                   /db_xref="InterPro:IPR028157"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ5"
FT                   /protein_id="BAH31307.1"
FT                   /translation="MNEPLVGPEFGSYAPGEVKWLLKDLSHVDLEADVSVREKRIQSGE
FT                   AHYAESLPIEYQPDQAYRDLFETVLAESAPRLARAVGTVMDLVLAERGSDITLVSLARA
FT                   GTPIGILMRRWAQQTRGLTLPHYAVSIVRGKGIDSVALDYLAHHHDSENVVFVDGWTGK
FT                   GAIARELDTALTEYHEAGGAKFDSDLAVLADPGHCVRTYGTRDDFLIASACLNSTVSGL
FT                   VSRTVLNDTLIGPGDFHGAKFYADLADVDVSNRLLDVVSAEFDSVRGDAADSLAAVLDS
FT                   DRTPTWAGWESVEKVQAEYGISTVNFVKPGVGETTRVLLRRLPWKVLVRELDAPEHAHI
FT                   RLLAQARGVPVEVVPDLAYSCVGLIKDIT"
     MNEPLVGPEF GSYAPGEVKW LLKDLSHVDL EADVSVREKR IQSGEAHYAE SLPIEYQPDQ        60
     AYRDLFETVL AESAPRLARA VGTVMDLVLA ERGSDITLVS LARAGTPIGI LMRRWAQQTR       120
     GLTLPHYAVS IVRGKGIDSV ALDYLAHHHD SENVVFVDGW TGKGAIAREL DTALTEYHEA       180
     GGAKFDSDLA VLADPGHCVR TYGTRDDFLI ASACLNSTVS GLVSRTVLND TLIGPGDFHG       240
     AKFYADLADV DVSNRLLDVV SAEFDSVRGD AADSLAAVLD SDRTPTWAGW ESVEKVQAEY       300
     GISTVNFVKP GVGETTRVLL RRLPWKVLVR ELDAPEHAHI RLLAQARGVP VEVVPDLAYS       360
     CVGLIKDIT                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page