(data stored in ACNUC1104 zone)

EMBL: AP008957.PE600

AP008957.PE600       Location/Qualifiers
FT   CDS             678947..679804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31308"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR024197"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ6"
FT                   /protein_id="BAH31308.1"
FT                   /translation="MSRADTAASQVLIATDLDRTMIYSQAAIGGDPSGSDLDSAPSPLC
FT                   VEYYNGGPLSHMSVESIELLTALSSRVPVIPTTTRTIAQFQRIDLPGGPWKYAITSNGG
FT                   NILVDGEVDREWRNEIDRSTSKSGAELPQVQAELESRIDSSWVSSIRVADDLFPYLVVD
FT                   LAVMPSEFETEWNHWCVTRGWNVSRQGRKIYTMPDAVSKSRALAEVRRRLVESGDLDQS
FT                   AVVISAGDGALDADMLEYSDFAIRPRHGELEELNWQRPTVTVTERSGIAASAEILRWFS
FT                   SALG"
     MSRADTAASQ VLIATDLDRT MIYSQAAIGG DPSGSDLDSA PSPLCVEYYN GGPLSHMSVE        60
     SIELLTALSS RVPVIPTTTR TIAQFQRIDL PGGPWKYAIT SNGGNILVDG EVDREWRNEI       120
     DRSTSKSGAE LPQVQAELES RIDSSWVSSI RVADDLFPYL VVDLAVMPSE FETEWNHWCV       180
     TRGWNVSRQG RKIYTMPDAV SKSRALAEVR RRLVESGDLD QSAVVISAGD GALDADMLEY       240
     SDFAIRPRHG ELEELNWQRP TVTVTERSGI AASAEILRWF SSALG                       285
//

If you have problems or comments...

PBIL Back to PBIL home page