(data stored in ACNUC1104 zone)

EMBL: AP008957.PE601

AP008957.PE601       Location/Qualifiers
FT   CDS             679832..681226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06010"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31309"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ7"
FT                   /protein_id="BAH31309.1"
FT                   /translation="MSVSLAKGQNGPLDVSDVVVSVQLAAAADLSALLVTSNGKVRSDA
FT                   DFVFFNQPTGPGVQLVPNPGGIASLRVSLAGVPADIEQVRAVITLDDASSNFGRSAAPT
FT                   ARVSDAAGNVLYEYVIDGLTTESIVIALEVYRRQGAWKVRAVGQGYAGGFAALVTDHGV
FT                   SVDDAPAPPPPTPVAAPAPITPPSSVAPTPPAYNQPPQQQPSYNAPPVPPAPPAYNQPP
FT                   AYNQGPTPPAYPPAQQPAYNQQPTYNQAPPAPPVQNQPPAQQPEVSLVKGRPVSLTKGQ
FT                   KVTLRKEGGVALTMIQMGLGWDPIKKSGLFGSRTADVDLDASALLYADGNLVDVCYYGQ
FT                   LTSKDGSVRHMGDNLTGDGDGDDEVMLVDLQRVPAHVTTVIFTVTSYRGHTFEQVSNAF
FT                   CRLVDSTTNSELARYTLQGGMAFTGMVMAKVYRANGEWKLQAIGEGIQAKHAGEAAPQL
FT                   GRFLTA"
     MSVSLAKGQN GPLDVSDVVV SVQLAAAADL SALLVTSNGK VRSDADFVFF NQPTGPGVQL        60
     VPNPGGIASL RVSLAGVPAD IEQVRAVITL DDASSNFGRS AAPTARVSDA AGNVLYEYVI       120
     DGLTTESIVI ALEVYRRQGA WKVRAVGQGY AGGFAALVTD HGVSVDDAPA PPPPTPVAAP       180
     APITPPSSVA PTPPAYNQPP QQQPSYNAPP VPPAPPAYNQ PPAYNQGPTP PAYPPAQQPA       240
     YNQQPTYNQA PPAPPVQNQP PAQQPEVSLV KGRPVSLTKG QKVTLRKEGG VALTMIQMGL       300
     GWDPIKKSGL FGSRTADVDL DASALLYADG NLVDVCYYGQ LTSKDGSVRH MGDNLTGDGD       360
     GDDEVMLVDL QRVPAHVTTV IFTVTSYRGH TFEQVSNAFC RLVDSTTNSE LARYTLQGGM       420
     AFTGMVMAKV YRANGEWKLQ AIGEGIQAKH AGEAAPQLGR FLTA                        464
//

If you have problems or comments...

PBIL Back to PBIL home page