(data stored in ACNUC1104 zone)

EMBL: AP008957.PE603

AP008957.PE603       Location/Qualifiers
FT   CDS             682319..683875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06030"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31311"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNQ9"
FT                   /protein_id="BAH31311.1"
FT                   /translation="MTFVPGQNAPLQAPVVTFRAESQTPFDVSALVADANLRALTSADF
FT                   VFYNQPSTAGVQLDQSGIRVELDRLHPDAAAVLCIVSVDPAATAAGAFRTAGLSATLSD
FT                   QSGSVLAEFAIPTAGTETAVICWELYRKSGAWKIRAVGQGYAGGLAELISVHGVEVDDE
FT                   PAQPAPTAAPAWDSAVEPLEVGRGLERAWMIFEDASRSAASFVSSSEYALARLDEDLTA
FT                   AVADPSLRNSAAGVAARDAAQKRHDDLVSLARDNHARDSAQLAHELGVIDGVLPRSMAS
FT                   WKSVSWAGTTDPAQITAVSDGMRLGELSAPDRGTLTVPYCVPLPLRRPIWVDSTSSKAA
FT                   LGLISAVTVRVMAAGPMPLLDVVDLTGSLTPLTDRLAPMLAGPVITAHTEISARLRALA
FT                   EAVDMGELARMSGVADGPSSLRLLILSDFPHGYSAEDAQTIMFLAERGPAIGLSILIVG
FT                   EDESNFAEESVAGLSEGCQHLSAAGQTEVHDPWTRTQWHFTPDVLDPISESRILAVFDR
FT                   T"
     MTFVPGQNAP LQAPVVTFRA ESQTPFDVSA LVADANLRAL TSADFVFYNQ PSTAGVQLDQ        60
     SGIRVELDRL HPDAAAVLCI VSVDPAATAA GAFRTAGLSA TLSDQSGSVL AEFAIPTAGT       120
     ETAVICWELY RKSGAWKIRA VGQGYAGGLA ELISVHGVEV DDEPAQPAPT AAPAWDSAVE       180
     PLEVGRGLER AWMIFEDASR SAASFVSSSE YALARLDEDL TAAVADPSLR NSAAGVAARD       240
     AAQKRHDDLV SLARDNHARD SAQLAHELGV IDGVLPRSMA SWKSVSWAGT TDPAQITAVS       300
     DGMRLGELSA PDRGTLTVPY CVPLPLRRPI WVDSTSSKAA LGLISAVTVR VMAAGPMPLL       360
     DVVDLTGSLT PLTDRLAPML AGPVITAHTE ISARLRALAE AVDMGELARM SGVADGPSSL       420
     RLLILSDFPH GYSAEDAQTI MFLAERGPAI GLSILIVGED ESNFAEESVA GLSEGCQHLS       480
     AAGQTEVHDP WTRTQWHFTP DVLDPISESR ILAVFDRT                               518
//

If you have problems or comments...

PBIL Back to PBIL home page