(data stored in ACNUC1104 zone)

EMBL: AP008957.PE604

AP008957.PE604       Location/Qualifiers
FT   CDS             683960..684415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06040"
FT                   /product="putative tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31312"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR0"
FT                   /protein_id="BAH31312.1"
FT                   /translation="MAFWDQLKAKAQEMNGQLKTKTSQFQNKEFKNASMAMCALIAAAD
FT                   GSIDPSERQKTAALIMSNESLAVFPPDELREQFDWYCSKLSSDYEFGKVEATATIAKLK
FT                   SKQDQARAVIQIGIIIGGADGNFDEHERGVVRDMCFAVGISPAEFDL"
     MAFWDQLKAK AQEMNGQLKT KTSQFQNKEF KNASMAMCAL IAAADGSIDP SERQKTAALI        60
     MSNESLAVFP PDELREQFDW YCSKLSSDYE FGKVEATATI AKLKSKQDQA RAVIQIGIII       120
     GGADGNFDEH ERGVVRDMCF AVGISPAEFD L                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page