(data stored in ACNUC1104 zone)

EMBL: AP008957.PE605

AP008957.PE605       Location/Qualifiers
FT   CDS             complement(684472..684993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31313"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR1"
FT                   /protein_id="BAH31313.1"
FT                   /translation="MLLHQSIGLERFNELPRQKAVHALFECCCSLTWAGWVSDGRPFAD
FT                   HAEILSRAEDAILNLSDVDVERALQCHPPVGVRRNSVPSHLEQCSIWVPDDAVMATIYR
FT                   AGEEYERNFGFRYLWCSHGHDADDLLENIGQRMSNERSVERKVCVDELAKITRTRIERM
FT                   LGPEDGYPEY"
     MLLHQSIGLE RFNELPRQKA VHALFECCCS LTWAGWVSDG RPFADHAEIL SRAEDAILNL        60
     SDVDVERALQ CHPPVGVRRN SVPSHLEQCS IWVPDDAVMA TIYRAGEEYE RNFGFRYLWC       120
     SHGHDADDLL ENIGQRMSNE RSVERKVCVD ELAKITRTRI ERMLGPEDGY PEY              173
//

If you have problems or comments...

PBIL Back to PBIL home page