(data stored in ACNUC1104 zone)

EMBL: AP008957.PE608

AP008957.PE608       Location/Qualifiers
FT   CDS             687206..688336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31316"
FT                   /db_xref="GOA:C0ZNR4"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR4"
FT                   /protein_id="BAH31316.1"
FT                   /translation="MIRRRLGQALMVIALASAAVSTAPVHAQEPSSITTPGAVTAATSL
FT                   PHSFWIPGAANASKLTYWSTGPLNQPALSTGALFLPPGDPPEGGWPVISWAHGTVGISD
FT                   QCAPTVTGTVGSPYLTNWLSQGYAIVATDYVGLGTPGIHAYLDGPSAAHSVIDMVRAAR
FT                   AVEPSLSPRWLALGQSQGGQAAMVTAAIATRYAPELDYGGAVATGAPSNLENLAPLVGP
FT                   DFPRLPLTGSTVFVSYLLAGLRAARPDLDIDRYLTPRGTDALARAETDCYQDMASGLGD
FT                   LTIGDLVNRPLDDPAVLAAARGMLEIPTTGYDRPVFLGQGLTDEMVPAPLALKLAAELA
FT                   ANRQPVTFRTYPTGHIETMRAALPESLSFVRNLFQP"
     MIRRRLGQAL MVIALASAAV STAPVHAQEP SSITTPGAVT AATSLPHSFW IPGAANASKL        60
     TYWSTGPLNQ PALSTGALFL PPGDPPEGGW PVISWAHGTV GISDQCAPTV TGTVGSPYLT       120
     NWLSQGYAIV ATDYVGLGTP GIHAYLDGPS AAHSVIDMVR AARAVEPSLS PRWLALGQSQ       180
     GGQAAMVTAA IATRYAPELD YGGAVATGAP SNLENLAPLV GPDFPRLPLT GSTVFVSYLL       240
     AGLRAARPDL DIDRYLTPRG TDALARAETD CYQDMASGLG DLTIGDLVNR PLDDPAVLAA       300
     ARGMLEIPTT GYDRPVFLGQ GLTDEMVPAP LALKLAAELA ANRQPVTFRT YPTGHIETMR       360
     AALPESLSFV RNLFQP                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page