(data stored in ACNUC1104 zone)

EMBL: AP008957.PE61

AP008957.PE61        Location/Qualifiers
FT   CDS             complement(77655..77975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30769"
FT                   /db_xref="GOA:C0ZLK1"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLK1"
FT                   /protein_id="BAH30769.1"
FT                   /translation="MKKILKRAAARTQQPAPAPTGCEELTNAPETDPAALTPGVCQECA
FT                   ELGEDNWSHLRMCLSCGHVGCCDSSPHQHATNHYRDTAHPVMRSHEPGESWRWCYVHDL
FT                   MD"
     MKKILKRAAA RTQQPAPAPT GCEELTNAPE TDPAALTPGV CQECAELGED NWSHLRMCLS        60
     CGHVGCCDSS PHQHATNHYR DTAHPVMRSH EPGESWRWCY VHDLMD                      106
//

If you have problems or comments...

PBIL Back to PBIL home page