(data stored in ACNUC1104 zone)

EMBL: AP008957.PE610

AP008957.PE610       Location/Qualifiers
FT   CDS             complement(689342..689890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06100"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31318"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR6"
FT                   /protein_id="BAH31318.1"
FT                   /translation="MSAQVIILTGPPGAGKSTLAAKLARGYSKGVHLHTDDFWHCIVSG
FT                   AIPPYDPTSDAQNQTVMDVIAGAAYTFARGDFATVIDGIIGPWMLPHFRTHATQHPNLA
FT                   VHYIVLRPQRDITLKRAQARTAPSALIDEGPILSMWDQFSDLGELDDHVLDTSGDEEEQ
FT                   SAQQVAAAIRDDRFRLFAQ"
     MSAQVIILTG PPGAGKSTLA AKLARGYSKG VHLHTDDFWH CIVSGAIPPY DPTSDAQNQT        60
     VMDVIAGAAY TFARGDFATV IDGIIGPWML PHFRTHATQH PNLAVHYIVL RPQRDITLKR       120
     AQARTAPSAL IDEGPILSMW DQFSDLGELD DHVLDTSGDE EEQSAQQVAA AIRDDRFRLF       180
     AQ                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page