(data stored in ACNUC1104 zone)

EMBL: AP008957.PE613

AP008957.PE613       Location/Qualifiers
FT   CDS             complement(693177..693995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31321"
FT                   /db_xref="GOA:C0ZNR9"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNR9"
FT                   /protein_id="BAH31321.1"
FT                   /translation="MDRRRFLSALAAATLTGTAAVTMGTACSSRSVGTAVAAADEPADP
FT                   AAVPNLPPALLPPPPPSARVPLPAGGSLTALPGGGDLFALTVDDGASSEVVRLYTQFAK
FT                   DTGIRLTYFVNGQYNSWTENAGLLRPLVESGQIQLGNHTYSHPDLTSVSKQQIADELTK
FT                   NGTFLRNTYGVDAAPYYRPPYGRHNATVDSVAASVGYTVPTLWYGSLSDSSLITEEYIL
FT                   QMANQYFNPGAIVIGHLNYLPVTHVYPQLVDLIRSRNLRTVTLNDVYLKP"
     MDRRRFLSAL AAATLTGTAA VTMGTACSSR SVGTAVAAAD EPADPAAVPN LPPALLPPPP        60
     PSARVPLPAG GSLTALPGGG DLFALTVDDG ASSEVVRLYT QFAKDTGIRL TYFVNGQYNS       120
     WTENAGLLRP LVESGQIQLG NHTYSHPDLT SVSKQQIADE LTKNGTFLRN TYGVDAAPYY       180
     RPPYGRHNAT VDSVAASVGY TVPTLWYGSL SDSSLITEEY ILQMANQYFN PGAIVIGHLN       240
     YLPVTHVYPQ LVDLIRSRNL RTVTLNDVYL KP                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page