(data stored in ACNUC1104 zone)

EMBL: AP008957.PE614

AP008957.PE614       Location/Qualifiers
FT   CDS             694118..695647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06140"
FT                   /product="putative LytR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06140"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31322"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZNS0"
FT                   /protein_id="BAH31322.1"
FT                   /translation="MEPRPRHSATRHRRRRQPQRSTLSVGRKLAAASLSTTILVGVGIG
FT                   WYVQSDLTSGLYRSDALSALGEDAGSSLDGDTNILLIGLDSRKAMDGSDLPAEFVTDKL
FT                   HAGDSDVGGYNTNTLILLHVPGDGGKASAVAIPRDDYVSVPGYGMAKIKEAYGMAKADA
FT                   DAKLVADGVTDPAAREQQAREVGRRSTLTTVQNLLKVPIDHFAEVNLMGFYDVVSAIGP
FT                   VQVCLNNPVQDDFSGANFPAGVQTLDASQALSFVRQRHGLDNGDLDRTHRQQAFISAVI
FT                   ANLKGSGVIGNIPKMTALADVVKKDVVIDSAMDPVRFASQASALAGGNIDFYTLPIEGY
FT                   ETVDGQDVNMVDPARLRSEVSRIFAGGDSASAPAMDTAISTGNEVVDIRNGTATDGLGA
FT                   ALAAAMKASGVEVGEVSTAAATAKSVVSYGVGAKAVAEALAEQLGVAAVPNEQAAAESV
FT                   SVLIGEDNAQTVFSAAPAQSDSSVSAGTVPDTGAQGSPIRADANGGIPCVD"
     MEPRPRHSAT RHRRRRQPQR STLSVGRKLA AASLSTTILV GVGIGWYVQS DLTSGLYRSD        60
     ALSALGEDAG SSLDGDTNIL LIGLDSRKAM DGSDLPAEFV TDKLHAGDSD VGGYNTNTLI       120
     LLHVPGDGGK ASAVAIPRDD YVSVPGYGMA KIKEAYGMAK ADADAKLVAD GVTDPAAREQ       180
     QAREVGRRST LTTVQNLLKV PIDHFAEVNL MGFYDVVSAI GPVQVCLNNP VQDDFSGANF       240
     PAGVQTLDAS QALSFVRQRH GLDNGDLDRT HRQQAFISAV IANLKGSGVI GNIPKMTALA       300
     DVVKKDVVID SAMDPVRFAS QASALAGGNI DFYTLPIEGY ETVDGQDVNM VDPARLRSEV       360
     SRIFAGGDSA SAPAMDTAIS TGNEVVDIRN GTATDGLGAA LAAAMKASGV EVGEVSTAAA       420
     TAKSVVSYGV GAKAVAEALA EQLGVAAVPN EQAAAESVSV LIGEDNAQTV FSAAPAQSDS       480
     SVSAGTVPDT GAQGSPIRAD ANGGIPCVD                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page