(data stored in ACNUC1104 zone)

EMBL: AP008957.PE630

AP008957.PE630       Location/Qualifiers
FT   CDS             710558..711046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06300"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31338"
FT                   /db_xref="GOA:C0ZPL0"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPL0"
FT                   /protein_id="BAH31338.1"
FT                   /translation="MTENDKGLKPTRISELVVLAAVAAVATWILIRVFYGSMPPIPVYA
FT                   GASLYFVAVAEAVFAFVIRSRVKNRQVGDGLRQLHPITAARALALAKASALVGSATVGV
FT                   WVGVLVYLIPQRSVLQAAASDTPGAWVGLGAAIALVAAALWLEHCCKTPEDTPDEPAH"
     MTENDKGLKP TRISELVVLA AVAAVATWIL IRVFYGSMPP IPVYAGASLY FVAVAEAVFA        60
     FVIRSRVKNR QVGDGLRQLH PITAARALAL AKASALVGSA TVGVWVGVLV YLIPQRSVLQ       120
     AAASDTPGAW VGLGAAIALV AAALWLEHCC KTPEDTPDEP AH                          162
//

If you have problems or comments...

PBIL Back to PBIL home page