(data stored in ACNUC1104 zone)

EMBL: AP008957.PE631

AP008957.PE631       Location/Qualifiers
FT   CDS             711115..712200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31339"
FT                   /db_xref="GOA:C0ZPL1"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPL1"
FT                   /protein_id="BAH31339.1"
FT                   /translation="MTNSGRSKSARRSKRSASQMIIAALLALAVIASLFLIFSNSVQLL
FT                   RVGLVVALWAATLGAIAMTKYRRESALDKAKVADLQTVYELQLEREISARREYELSVEG
FT                   RVRREVTADAEELAGLRAELVALRRNLEALFEGGLLPEQTALKTDSTRVPELGGSSYGA
FT                   YQPAPSGLYVPGAGQSGPSQPTPNVGGLASPNDDPVTAETTVVFAETSWRDSSFVAPRV
FT                   IPTQKSQETQKPQSGNQAPSSPVSSSPSRTVKDVPVKKDPEPVAPVEPEVKAPAQAPNI
FT                   EDAVIEDAVVEEAPEVVPEIVAEAEPAAEPDAEPRRRRRAAPEDAASGAHSNGLTVAEI
FT                   MANLSSSNPSEGSGRRRRRED"
     MTNSGRSKSA RRSKRSASQM IIAALLALAV IASLFLIFSN SVQLLRVGLV VALWAATLGA        60
     IAMTKYRRES ALDKAKVADL QTVYELQLER EISARREYEL SVEGRVRREV TADAEELAGL       120
     RAELVALRRN LEALFEGGLL PEQTALKTDS TRVPELGGSS YGAYQPAPSG LYVPGAGQSG       180
     PSQPTPNVGG LASPNDDPVT AETTVVFAET SWRDSSFVAP RVIPTQKSQE TQKPQSGNQA       240
     PSSPVSSSPS RTVKDVPVKK DPEPVAPVEP EVKAPAQAPN IEDAVIEDAV VEEAPEVVPE       300
     IVAEAEPAAE PDAEPRRRRR AAPEDAASGA HSNGLTVAEI MANLSSSNPS EGSGRRRRRE       360
     D                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page