(data stored in ACNUC1104 zone)

EMBL: AP008957.PE632

AP008957.PE632       Location/Qualifiers
FT   CDS             712311..713252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31340"
FT                   /db_xref="GOA:C0ZPL2"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPL2"
FT                   /protein_id="BAH31340.1"
FT                   /translation="MTSFGITNGPAPARLTVGIVSAGRVGTAVGAALERAGHVVSACSA
FT                   VSSASVARAVKRLPDTEILPAADVAARSELLILAVPDDQLADLVRGLAATQAVKPGTLV
FT                   AHTSGANGIAILTPLTELGALPLAIHPAMTFTGHDEDTARLSSACFGITAADDIGYAIA
FT                   QSLVLEIGGEPVRVREENRALYHAALAHGSNHLVTLVVDAVEALRASLQGDELLGQQLV
FT                   DGDPGGVAERVLQPLLSAALDNALRRGPSALTGPVARGDAAAVDTHLRVLTELDPELAA
FT                   GYRAMSLRSAQRVGAPTELFDILTETGGDRRE"
     MTSFGITNGP APARLTVGIV SAGRVGTAVG AALERAGHVV SACSAVSSAS VARAVKRLPD        60
     TEILPAADVA ARSELLILAV PDDQLADLVR GLAATQAVKP GTLVAHTSGA NGIAILTPLT       120
     ELGALPLAIH PAMTFTGHDE DTARLSSACF GITAADDIGY AIAQSLVLEI GGEPVRVREE       180
     NRALYHAALA HGSNHLVTLV VDAVEALRAS LQGDELLGQQ LVDGDPGGVA ERVLQPLLSA       240
     ALDNALRRGP SALTGPVARG DAAAVDTHLR VLTELDPELA AGYRAMSLRS AQRVGAPTEL       300
     FDILTETGGD RRE                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page