(data stored in ACNUC1104 zone)

EMBL: AP008957.PE635

AP008957.PE635       Location/Qualifiers
FT   CDS             714655..715470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31343"
FT                   /db_xref="GOA:C0ZPL5"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZPL5"
FT                   /protein_id="BAH31343.1"
FT                   /translation="MLLTVDVRNTNIVLGLFSGTGEYSKLLQDWRMRTDPRMTADELAL
FT                   TFRGLLGTHVDEITGVAALSTVPSVLREIRVMLERYWGHVPHVVVEPGIRTGVPLLVDN
FT                   PKEVGADRIVNSLAAHHLYEGPCIVVDFGTSTCVDVVSAKGEFLGGCIAPGLEISTDAL
FT                   ASQSAALRKVELVRPRSVVGKNTVECMQSGAVFGFAGLVDGLVNRVRDELPEFGGDDVS
FT                   VIATGDSAPLIIPESDTIDHLERDLTLEGLRLVFERNQARRGSGRRPVA"
     MLLTVDVRNT NIVLGLFSGT GEYSKLLQDW RMRTDPRMTA DELALTFRGL LGTHVDEITG        60
     VAALSTVPSV LREIRVMLER YWGHVPHVVV EPGIRTGVPL LVDNPKEVGA DRIVNSLAAH       120
     HLYEGPCIVV DFGTSTCVDV VSAKGEFLGG CIAPGLEIST DALASQSAAL RKVELVRPRS       180
     VVGKNTVECM QSGAVFGFAG LVDGLVNRVR DELPEFGGDD VSVIATGDSA PLIIPESDTI       240
     DHLERDLTLE GLRLVFERNQ ARRGSGRRPV A                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page