(data stored in ACNUC1104 zone)

EMBL: AP008957.PE637

AP008957.PE637       Location/Qualifiers
FT   CDS             716247..716669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31345"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPL7"
FT                   /protein_id="BAH31345.1"
FT                   /translation="MTIDQMLDDARAQIDRMYVFQLTEAFHRGAIFVDIRPQAQRAIEG
FT                   TLPGALAIERNVLEWRLDPTSSAHLALATDHDVEWVIVCSEGYTSSLAAASLQQLGLHK
FT                   ATDLVGGYQAIKAAGLLGALSGVRHCSRELAAVSAH"
     MTIDQMLDDA RAQIDRMYVF QLTEAFHRGA IFVDIRPQAQ RAIEGTLPGA LAIERNVLEW        60
     RLDPTSSAHL ALATDHDVEW VIVCSEGYTS SLAAASLQQL GLHKATDLVG GYQAIKAAGL       120
     LGALSGVRHC SRELAAVSAH                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page