(data stored in ACNUC1104 zone)

EMBL: AP008957.PE642

AP008957.PE642       Location/Qualifiers
FT   CDS             complement(720814..721263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06420"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31350"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPM2"
FT                   /protein_id="BAH31350.1"
FT                   /translation="MGLISAGYASRLVLRQRQCRYIPCGASGDASRRGNHDRRRLETRP
FT                   LPSAIFASKNGTLASIAYSGPTNFTISGRPAIRHTATVTNIPADKECDPPSAHFDVVTT
FT                   PGHSTAEVMVVLVQSDQGLPEHSTRARSTKSSQQFESPRLRRPHG"
     MGLISAGYAS RLVLRQRQCR YIPCGASGDA SRRGNHDRRR LETRPLPSAI FASKNGTLAS        60
     IAYSGPTNFT ISGRPAIRHT ATVTNIPADK ECDPPSAHFD VVTTPGHSTA EVMVVLVQSD       120
     QGLPEHSTRA RSTKSSQQFE SPRLRRPHG                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page