(data stored in ACNUC1104 zone)

EMBL: AP008957.PE65

AP008957.PE65        Location/Qualifiers
FT   CDS             82450..83535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00650"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00650"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30773"
FT                   /db_xref="GOA:C0ZL83"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL83"
FT                   /protein_id="BAH30773.1"
FT                   /translation="MTPDGAAPSPAPSEVMTYRQQTVLLAPGPVETLEQPKNLVLIGSI
FT                   LTVIGVALLGTALFGSAIMMTVRIVLALVALVFLFKGLGKLGTSKWGSQFDLSYWLACI
FT                   WLAALILAAIFAPLLPLGEYKDTVKTLAEPGFASPSLLSDHPLGTNNFGLDLLARALFG
FT                   ARASLTVAICAVLIGMIIGGTIGVMAGYFRGKVDAVVGILTNSLLAIPSLVLLIALAAV
FT                   LTSNLRNITLALSILCIPSMVRIARANTIVVAQREFVLAARAMGATKWRVIWRELVPNV
FT                   LVPVAALGLVAVSGLIVAEASLSFLGLGIAQPDPTWGNMIAEGQGGIVEKHPFIVLVPG
FT                   VFLFLTVFSFNLIGEKYRSKL"
     MTPDGAAPSP APSEVMTYRQ QTVLLAPGPV ETLEQPKNLV LIGSILTVIG VALLGTALFG        60
     SAIMMTVRIV LALVALVFLF KGLGKLGTSK WGSQFDLSYW LACIWLAALI LAAIFAPLLP       120
     LGEYKDTVKT LAEPGFASPS LLSDHPLGTN NFGLDLLARA LFGARASLTV AICAVLIGMI       180
     IGGTIGVMAG YFRGKVDAVV GILTNSLLAI PSLVLLIALA AVLTSNLRNI TLALSILCIP       240
     SMVRIARANT IVVAQREFVL AARAMGATKW RVIWRELVPN VLVPVAALGL VAVSGLIVAE       300
     ASLSFLGLGI AQPDPTWGNM IAEGQGGIVE KHPFIVLVPG VFLFLTVFSF NLIGEKYRSK       360
     L                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page