(data stored in ACNUC1104 zone)

EMBL: AP008957.PE655

AP008957.PE655       Location/Qualifiers
FT   CDS             733784..734974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06550"
FT                   /product="putative two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06550"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31363"
FT                   /db_xref="GOA:C0ZPN5"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPN5"
FT                   /protein_id="BAH31363.1"
FT                   /translation="MRRRVWTTAAVAFSLFCSFMTVGIAGASGNMPPALVGIGFVLGVA
FT                   GGISLVWRHQHPWVVLAITLVGPLFFPTDATAALIALFAVARIARGPRLAAAAAAVFVV
FT                   CGISLTYDAFRNREYSVLTMGTAKPKDGSVVVQYDVAIWIPWLVAAVMVGIVVALSLLI
FT                   RTRTELVEAEHVRDLATEKTDVMRDEMIRTEERTRIARDMHDTIAASLSRISLFAGGLQ
FT                   VSAADNPEKVVNTAAMIRTTAHEALDELKGIVGVLRGSGDRREHGGHQGIDAIGDLVNS
FT                   ARAAGIHCRLESELLPGDVGMLAGHVCYRVVQESLTNVQKYASDQMLVISVTGSPHEGI
FT                   RILARNKLSELAPMTSIGSRSGLRGLAEQAREIGGKVEAGALGDDFLVSCWVPWSS"
     MRRRVWTTAA VAFSLFCSFM TVGIAGASGN MPPALVGIGF VLGVAGGISL VWRHQHPWVV        60
     LAITLVGPLF FPTDATAALI ALFAVARIAR GPRLAAAAAA VFVVCGISLT YDAFRNREYS       120
     VLTMGTAKPK DGSVVVQYDV AIWIPWLVAA VMVGIVVALS LLIRTRTELV EAEHVRDLAT       180
     EKTDVMRDEM IRTEERTRIA RDMHDTIAAS LSRISLFAGG LQVSAADNPE KVVNTAAMIR       240
     TTAHEALDEL KGIVGVLRGS GDRREHGGHQ GIDAIGDLVN SARAAGIHCR LESELLPGDV       300
     GMLAGHVCYR VVQESLTNVQ KYASDQMLVI SVTGSPHEGI RILARNKLSE LAPMTSIGSR       360
     SGLRGLAEQA REIGGKVEAG ALGDDFLVSC WVPWSS                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page