(data stored in ACNUC1104 zone)

EMBL: AP008957.PE658

AP008957.PE658       Location/Qualifiers
FT   CDS             complement(736355..737695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06580"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31366"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPN8"
FT                   /protein_id="BAH31366.1"
FT                   /translation="MSSLKAASSLKAVSSLKKRLPEPAMPPGEDPRDYARTLAAVYDAT
FT                   MAGDRAPARPRDVVRQSWQRLRELGIDPEHSRVEPSMDVAELDLRRRESGLYDVLDDVT
FT                   RGLESITASGENIMVVADLRGTVLWRSGSHRVLDQAARLGFVEGANWAEDSVGTNAIGT
FT                   ALVSRQAVQIFSAEHYARSHHPWTCAGAPIRDPRDDRVIGVVDISGPAKTVHPTTLALV
FT                   DAVARLAQSHLRDKHRDNLDQLRSVAGPMLARSGSPALVIDTHGWVAAVDALPHRSRVL
FT                   LPAALAPGRAWFPALGLCELDPLPGGWLVRPITTGERISAPTVHIDLRDSENMSVTVTS
FT                   GFGEWAYAPTQRHAEILFLLGSERRGLTASRLAQDLFGDPARTVTARAEMSRLRKNLAG
FT                   VVAAQPYRFVDAAHVTLSCPVNGAHLLPFSNAPAVRAARLSQAGSEA"
     MSSLKAASSL KAVSSLKKRL PEPAMPPGED PRDYARTLAA VYDATMAGDR APARPRDVVR        60
     QSWQRLRELG IDPEHSRVEP SMDVAELDLR RRESGLYDVL DDVTRGLESI TASGENIMVV       120
     ADLRGTVLWR SGSHRVLDQA ARLGFVEGAN WAEDSVGTNA IGTALVSRQA VQIFSAEHYA       180
     RSHHPWTCAG APIRDPRDDR VIGVVDISGP AKTVHPTTLA LVDAVARLAQ SHLRDKHRDN       240
     LDQLRSVAGP MLARSGSPAL VIDTHGWVAA VDALPHRSRV LLPAALAPGR AWFPALGLCE       300
     LDPLPGGWLV RPITTGERIS APTVHIDLRD SENMSVTVTS GFGEWAYAPT QRHAEILFLL       360
     GSERRGLTAS RLAQDLFGDP ARTVTARAEM SRLRKNLAGV VAAQPYRFVD AAHVTLSCPV       420
     NGAHLLPFSN APAVRAARLS QAGSEA                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page