(data stored in ACNUC1104 zone)

EMBL: AP008957.PE66

AP008957.PE66        Location/Qualifiers
FT   CDS             83532..84629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00660"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30774"
FT                   /db_xref="GOA:C0ZL84"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL84"
FT                   /protein_id="BAH30774.1"
FT                   /translation="MTTSVQNGVPLLQADNIRTVFATPRGQLRAVDGVSIHVSAGETLG
FT                   IVGESGSGKSVLGRTIMGLLQKGPALDISGTVTFAGRDMSTMKKSEMKHFWGPEIAMVF
FT                   QDPMTSLNPFKRIGTHITESLKFHLGLKKDAARDRAAELLSMVGIPEPKRRLDQYPHEL
FT                   SGGMRQRVVIAMALACEPKLLIADEPTTALDVTVQKQILDLLASLNDKLNMAVILISHD
FT                   LGVVSGRSDRVAVMYAGSVVETSATEELFTRPRHPYTEALMAAIPRLESPTHTVLQTIP
FT                   GGLPDMTKPITGCRFAARCRYAQDDCLTGEPALAPGGLGDNTTESHTFACHYPVDTPEG
FT                   TTALVANEKAGTTAAGLSLAVKEMV"
     MTTSVQNGVP LLQADNIRTV FATPRGQLRA VDGVSIHVSA GETLGIVGES GSGKSVLGRT        60
     IMGLLQKGPA LDISGTVTFA GRDMSTMKKS EMKHFWGPEI AMVFQDPMTS LNPFKRIGTH       120
     ITESLKFHLG LKKDAARDRA AELLSMVGIP EPKRRLDQYP HELSGGMRQR VVIAMALACE       180
     PKLLIADEPT TALDVTVQKQ ILDLLASLND KLNMAVILIS HDLGVVSGRS DRVAVMYAGS       240
     VVETSATEEL FTRPRHPYTE ALMAAIPRLE SPTHTVLQTI PGGLPDMTKP ITGCRFAARC       300
     RYAQDDCLTG EPALAPGGLG DNTTESHTFA CHYPVDTPEG TTALVANEKA GTTAAGLSLA       360
     VKEMV                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page