(data stored in ACNUC1104 zone)

EMBL: AP008957.PE660

AP008957.PE660       Location/Qualifiers
FT   CDS             738700..739845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06600"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31368"
FT                   /db_xref="GOA:C0ZPP0"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP0"
FT                   /protein_id="BAH31368.1"
FT                   /translation="MTATVDTPTEPATPSRQPSRRWIGFGIANLVIVLVLAVASWYLLA
FT                   DPTTSPWSFYPLPFNAALFWAILFVVFIGFNCEFAGFDRLPQPAKGLAIMVATAVFAVV
FT                   VTWLLANGLGSLYPDFAADREGGLGYFAGALFVLFGFGTWVMVVLNWQHWPWTSLGMKQ
FT                   PLVGLCEIAFVAVPTLALYFVFGLPSVSLSATDPLMTVDTVLGWFYCVVVVVILTGQTL
FT                   DNWPWRLFGGGGKTALAATIGNFAVGTGLYFVALPVVKALVGSDAVAELGGVVHQFPAQ
FT                   LGVCWAFWMIFWANAFGNKPTGFSDGVNLAIRALFTFALAVVTFLFYYRFAAEHILHEP
FT                   AVVDGLHGNALGFVDWAVLWTLFYVVGFQSLGLGKFKPAEG"
     MTATVDTPTE PATPSRQPSR RWIGFGIANL VIVLVLAVAS WYLLADPTTS PWSFYPLPFN        60
     AALFWAILFV VFIGFNCEFA GFDRLPQPAK GLAIMVATAV FAVVVTWLLA NGLGSLYPDF       120
     AADREGGLGY FAGALFVLFG FGTWVMVVLN WQHWPWTSLG MKQPLVGLCE IAFVAVPTLA       180
     LYFVFGLPSV SLSATDPLMT VDTVLGWFYC VVVVVILTGQ TLDNWPWRLF GGGGKTALAA       240
     TIGNFAVGTG LYFVALPVVK ALVGSDAVAE LGGVVHQFPA QLGVCWAFWM IFWANAFGNK       300
     PTGFSDGVNL AIRALFTFAL AVVTFLFYYR FAAEHILHEP AVVDGLHGNA LGFVDWAVLW       360
     TLFYVVGFQS LGLGKFKPAE G                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page