(data stored in ACNUC1104 zone)

EMBL: AP008957.PE662

AP008957.PE662       Location/Qualifiers
FT   CDS             complement(741881..742657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06620"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06620"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31370"
FT                   /db_xref="GOA:C0ZPP2"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP2"
FT                   /protein_id="BAH31370.1"
FT                   /translation="MPLVDNFTKLLIRGLLAGLIAGILAGGVAFVLGEPHVNAAIAIEE
FT                   ANSATGEVAGEAAGHSHGDEEEPLVSRDGQRAGLFLATALAGLALGAIFSVVANYARRL
FT                   TGMSGPLLAITIAVGGWLAIEAVPFFKYPANPPAVGDPDTINQRTLLWLAAVILGLLSV
FT                   TAAAAAAKAVSGHEFLSVRIAAPVAAFLVIATIGYVSLPGINEVGEDFPATLLWEFRLS
FT                   SLATQATLWLVLGLAFAFLTERATKNTEVAKKYALR"
     MPLVDNFTKL LIRGLLAGLI AGILAGGVAF VLGEPHVNAA IAIEEANSAT GEVAGEAAGH        60
     SHGDEEEPLV SRDGQRAGLF LATALAGLAL GAIFSVVANY ARRLTGMSGP LLAITIAVGG       120
     WLAIEAVPFF KYPANPPAVG DPDTINQRTL LWLAAVILGL LSVTAAAAAA KAVSGHEFLS       180
     VRIAAPVAAF LVIATIGYVS LPGINEVGED FPATLLWEFR LSSLATQATL WLVLGLAFAF       240
     LTERATKNTE VAKKYALR                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page