(data stored in ACNUC1104 zone)

EMBL: AP008957.PE663

AP008957.PE663       Location/Qualifiers
FT   CDS             complement(742648..742842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06630"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31371"
FT                   /db_xref="GOA:C0ZPP3"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP3"
FT                   /protein_id="BAH31371.1"
FT                   /translation="MALAYSPDTSIDSTRLAFLAAAVVLFAMLALYLVGFDQGAISRTG
FT                   MYMHELMHDGRHLMGLPCH"
     MALAYSPDTS IDSTRLAFLA AAVVLFAMLA LYLVGFDQGA ISRTGMYMHE LMHDGRHLMG        60
     LPCH                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page