(data stored in ACNUC1104 zone)

EMBL: AP008957.PE664

AP008957.PE664       Location/Qualifiers
FT   CDS             complement(743094..743402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31372"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP4"
FT                   /protein_id="BAH31372.1"
FT                   /translation="MAVVKINAIEVPEGAGPELEKRFAARAHAVENSPGFLGFQLLRPT
FT                   AGESRYFVVTQWESEQAFADWRDGPAREAHSGERAKPVASGASLLEFEVVLDVAAKS"
     MAVVKINAIE VPEGAGPELE KRFAARAHAV ENSPGFLGFQ LLRPTAGESR YFVVTQWESE        60
     QAFADWRDGP AREAHSGERA KPVASGASLL EFEVVLDVAA KS                          102
//

If you have problems or comments...

PBIL Back to PBIL home page