(data stored in ACNUC1104 zone)

EMBL: AP008957.PE669

AP008957.PE669       Location/Qualifiers
FT   CDS             748510..749544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31377"
FT                   /db_xref="GOA:C0ZPP9"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPP9"
FT                   /protein_id="BAH31377.1"
FT                   /translation="MEDPVRESLGVVFENNSISTALVDADTPLLGSIDEFRHPWGANGT
FT                   VPSAQASARALASAAEVATGRALRSNLCPTVVGVMCERADVRELVPGSLSSSTFENIEL
FT                   VNGLDARIAYLRTVDALNGISPILAFWPDGGETVIAAIDPSAGVVDSAHRYATAELLTD
FT                   SSTFAATLDLLVAERDPVPKMLVAMLVKEESRQLSAEAAESAGLGFLYLGERAQLAIGA
FT                   ALVAAGRGSEVRSAGGAAVQPVNRIRWAAAIVLPLLLMLTGLLIALSPDGSRAVSTDRP
FT                   NVGAEPANPTSGPPSGAALPILTLPPCDPVVPVVPAAFRRSDPDVTPPQTVEPAEACDP
FT                   MRVG"
     MEDPVRESLG VVFENNSIST ALVDADTPLL GSIDEFRHPW GANGTVPSAQ ASARALASAA        60
     EVATGRALRS NLCPTVVGVM CERADVRELV PGSLSSSTFE NIELVNGLDA RIAYLRTVDA       120
     LNGISPILAF WPDGGETVIA AIDPSAGVVD SAHRYATAEL LTDSSTFAAT LDLLVAERDP       180
     VPKMLVAMLV KEESRQLSAE AAESAGLGFL YLGERAQLAI GAALVAAGRG SEVRSAGGAA       240
     VQPVNRIRWA AAIVLPLLLM LTGLLIALSP DGSRAVSTDR PNVGAEPANP TSGPPSGAAL       300
     PILTLPPCDP VVPVVPAAFR RSDPDVTPPQ TVEPAEACDP MRVG                        344
//

If you have problems or comments...

PBIL Back to PBIL home page