(data stored in ACNUC1104 zone)

EMBL: AP008957.PE67

AP008957.PE67        Location/Qualifiers
FT   CDS             84629..85618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00670"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30775"
FT                   /db_xref="GOA:C0ZL85"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL85"
FT                   /protein_id="BAH30775.1"
FT                   /translation="MTAATDTRKPETVDAALTVEDLVVEFNVGKGQTVHAVSGISFTVA
FT                   PGETLGVVGESGCGKSTAGRAIMQLPSPTSGSIRLGETEMTALGAEELRRSRTQLQMIF
FT                   QDPISSLNPRRKVKALITEGPSIWGGKDKAAIEARAREVLAEVGLDPDMVWDRTPRELS
FT                   GGQCQRVCIARALMLDPKVLICDEPVSSLDVSVQAQILNLLEDAKKRHGLSLLFIAHNM
FT                   AVVKNISDRVMIMYLGRVCEIVPAEDMQNRALHPYTQLLLSSIPDPDATVTAAQNVEQK
FT                   VIELPSPLNPPSGCRFRTRCPLATDLCAEEVPELRLVQGGHQVACHNV"
     MTAATDTRKP ETVDAALTVE DLVVEFNVGK GQTVHAVSGI SFTVAPGETL GVVGESGCGK        60
     STAGRAIMQL PSPTSGSIRL GETEMTALGA EELRRSRTQL QMIFQDPISS LNPRRKVKAL       120
     ITEGPSIWGG KDKAAIEARA REVLAEVGLD PDMVWDRTPR ELSGGQCQRV CIARALMLDP       180
     KVLICDEPVS SLDVSVQAQI LNLLEDAKKR HGLSLLFIAH NMAVVKNISD RVMIMYLGRV       240
     CEIVPAEDMQ NRALHPYTQL LLSSIPDPDA TVTAAQNVEQ KVIELPSPLN PPSGCRFRTR       300
     CPLATDLCAE EVPELRLVQG GHQVACHNV                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page