(data stored in ACNUC1104 zone)

EMBL: AP008957.PE671

AP008957.PE671       Location/Qualifiers
FT   CDS             complement(750539..751093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31379"
FT                   /db_xref="GOA:C0ZPQ1"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPQ1"
FT                   /protein_id="BAH31379.1"
FT                   /translation="MTETPQSQTPDSPTPESPTPTIVEKPKRLRKQTLLIVAGVLVVVA
FT                   ALGWGAFATWQKSADEDARTSALDSGRQFATDLATYNFQNLDQNLSVVRDNSVGEFAGQ
FT                   YAQVAANLQNMIVQYQATSSAQIISAGLASSDRDNAEVLVFLDQTITNTNSPDPRIDRN
FT                   RMQLSLVREDGEWKLSNVQLL"
     MTETPQSQTP DSPTPESPTP TIVEKPKRLR KQTLLIVAGV LVVVAALGWG AFATWQKSAD        60
     EDARTSALDS GRQFATDLAT YNFQNLDQNL SVVRDNSVGE FAGQYAQVAA NLQNMIVQYQ       120
     ATSSAQIISA GLASSDRDNA EVLVFLDQTI TNTNSPDPRI DRNRMQLSLV REDGEWKLSN       180
     VQLL                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page