(data stored in ACNUC1104 zone)

EMBL: AP008957.PE686

AP008957.PE686       Location/Qualifiers
FT   CDS             765266..765754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06860"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31394"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPR6"
FT                   /protein_id="BAH31394.1"
FT                   /translation="MIFKVGDTVVYPHHGAALIEAIETRTIKGEQKEYLVLKVAQGDLT
FT                   VRVPADNAEYVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKV
FT                   AEVVRDLWRREQDRGLSAGEKRMLAKARQILVGELALAEGTDTEKAETILDEVLAAAS"
     MIFKVGDTVV YPHHGAALIE AIETRTIKGE QKEYLVLKVA QGDLTVRVPA DNAEYVGVRD        60
     VVGQEGLDKV FQVLRAPHTE EPTNWSRRYK ANLEKLASGD VNKVAEVVRD LWRREQDRGL       120
     SAGEKRMLAK ARQILVGELA LAEGTDTEKA ETILDEVLAA AS                          162
//

If you have problems or comments...

PBIL Back to PBIL home page