(data stored in ACNUC1104 zone)

EMBL: AP008957.PE69

AP008957.PE69        Location/Qualifiers
FT   CDS             complement(86224..87633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00690"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30777"
FT                   /db_xref="GOA:C0ZL87"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL87"
FT                   /protein_id="BAH30777.1"
FT                   /translation="MDRSTTRVRSSLIFVAILVVALAGIAARPPGFLSTFWPANAILLG
FT                   ILLRNPRSFAPIGLAVGGAALLTADLATGSPVQRAFELNAINLVGVTTGLIAANLLGCF
FT                   PRRISETKYTTRIFVVSVLASFTAGSASALRTQLHEGSGAGTELVGWFFADLCTYLIVL
FT                   PILLSAPPFDHVRRTFGPSVRQNLRLRRVAQILLPLAALLACLPLALEVQGALALLLPM
FT                   PALLWCAMRVSLFSTSLLAAGWSAWALIMAGQGRLALADPVHLLSEGVTTRISVILMAL
FT                   SPIAVAVATGAQRRAERELQRIAECDALTGTLSRHAFWTQSQELLDTQHTARKSIAVMM
FT                   LDLDHFKSINDNLGHLTGDSVLEQFGNTLLATTEGLGLSGRLGGEEFAVAAADCTFEEA
FT                   IALAERIRQRQEAHSRSIRGFAGTVSIGVAWVDQAMAEMDALLDIADTAMYQAKREGRN
FT                   LVVAVDLYMAR"
     MDRSTTRVRS SLIFVAILVV ALAGIAARPP GFLSTFWPAN AILLGILLRN PRSFAPIGLA        60
     VGGAALLTAD LATGSPVQRA FELNAINLVG VTTGLIAANL LGCFPRRISE TKYTTRIFVV       120
     SVLASFTAGS ASALRTQLHE GSGAGTELVG WFFADLCTYL IVLPILLSAP PFDHVRRTFG       180
     PSVRQNLRLR RVAQILLPLA ALLACLPLAL EVQGALALLL PMPALLWCAM RVSLFSTSLL       240
     AAGWSAWALI MAGQGRLALA DPVHLLSEGV TTRISVILMA LSPIAVAVAT GAQRRAEREL       300
     QRIAECDALT GTLSRHAFWT QSQELLDTQH TARKSIAVMM LDLDHFKSIN DNLGHLTGDS       360
     VLEQFGNTLL ATTEGLGLSG RLGGEEFAVA AADCTFEEAI ALAERIRQRQ EAHSRSIRGF       420
     AGTVSIGVAW VDQAMAEMDA LLDIADTAMY QAKREGRNLV VAVDLYMAR                   469
//

If you have problems or comments...

PBIL Back to PBIL home page