(data stored in ACNUC1104 zone)

EMBL: AP008957.PE693

AP008957.PE693       Location/Qualifiers
FT   CDS             772979..773968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06930"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31401"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPS3"
FT                   /protein_id="BAH31401.1"
FT                   /translation="MKSTTRIVAALAAIALLAGCQSSTESTASEDTTQLAEAGALPATI
FT                   AHAYGSTTIETEPQRIVTIGWNSQDSVLALGKTPVAMESFSGAGLENGILPWDEELLGD
FT                   VEPTLLDSTSGVPFEQILALEPDVIIAVVSGITEDDYARLSQIAPTIPFKETAWATTWQ
FT                   EQMSTIGSVLGQPKRAAELIEETDDSIADLAAGSPNLNGKTLTFLSGNIDGLTNYCADD
FT                   GRVILMSQLGLKQSAGSAELCGDTQGSVTASREQYNELDADVIVLNDASGQGLPGLMGD
FT                   KLFADLPAVKDGRLIQQLGLARVMALASPTSLSVKYAFAELVSKMNGF"
     MKSTTRIVAA LAAIALLAGC QSSTESTASE DTTQLAEAGA LPATIAHAYG STTIETEPQR        60
     IVTIGWNSQD SVLALGKTPV AMESFSGAGL ENGILPWDEE LLGDVEPTLL DSTSGVPFEQ       120
     ILALEPDVII AVVSGITEDD YARLSQIAPT IPFKETAWAT TWQEQMSTIG SVLGQPKRAA       180
     ELIEETDDSI ADLAAGSPNL NGKTLTFLSG NIDGLTNYCA DDGRVILMSQ LGLKQSAGSA       240
     ELCGDTQGSV TASREQYNEL DADVIVLNDA SGQGLPGLMG DKLFADLPAV KDGRLIQQLG       300
     LARVMALASP TSLSVKYAFA ELVSKMNGF                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page