(data stored in ACNUC1104 zone)

EMBL: AP008957.PE698

AP008957.PE698       Location/Qualifiers
FT   CDS             complement(777541..778413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_06980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_06980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31406"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPS8"
FT                   /protein_id="BAH31406.1"
FT                   /translation="MAWLEVVRTGPLATVQDRGRRGYGALGVGRSGAVDMISHDSANRL
FT                   VGNTFRAATIEVTTGGFAMRAVGSMTVAVTGARVPLAVDGRPAPDYASIHLGGGSIIEL
FT                   GYSTTGLRTYISARGGVDVPQVLGSRSTDTLSGLGPPPLAAGDLLLLGAEEGTWPTEEL
FT                   IPPPAPALGAVPIEITLGPRNSWFTAASVHALLHTTWKVTEHTNRVGVRLQGQGPLHRS
FT                   RTEELPSEGVVMGSIQVPPGGQPVVFLADHPVTGGYPVIAVVSDAGIASLAQLRPGSTI
FT                   TLKATTRPS"
     MAWLEVVRTG PLATVQDRGR RGYGALGVGR SGAVDMISHD SANRLVGNTF RAATIEVTTG        60
     GFAMRAVGSM TVAVTGARVP LAVDGRPAPD YASIHLGGGS IIELGYSTTG LRTYISARGG       120
     VDVPQVLGSR STDTLSGLGP PPLAAGDLLL LGAEEGTWPT EELIPPPAPA LGAVPIEITL       180
     GPRNSWFTAA SVHALLHTTW KVTEHTNRVG VRLQGQGPLH RSRTEELPSE GVVMGSIQVP       240
     PGGQPVVFLA DHPVTGGYPV IAVVSDAGIA SLAQLRPGST ITLKATTRPS                  290
//

If you have problems or comments...

PBIL Back to PBIL home page