(data stored in ACNUC1104 zone)

EMBL: AP008957.PE700

AP008957.PE700       Location/Qualifiers
FT   CDS             complement(779082..779843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_07000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_07000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31408"
FT                   /db_xref="GOA:C0ZPT0"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZPT0"
FT                   /protein_id="BAH31408.1"
FT                   /translation="MGYSVDLNSDLGEGFGAWTLGDDDAMLELVTSANIACGFHAGDPT
FT                   TLLATCESAATRGVRIGAQVGYRDLAGFGRRFIDMSPKDLTADVIYQIGALDGLARVAG
FT                   SRVTYVKPHGALYNAIVHHRRQARAVVAAVVAYDSSLPVLGLPGSVFLEEAREAGLDVV
FT                   AEAFADRAYTAEGTLVPRTESGAVLNDPALVAERVRRMVVDGELDAVDGSTLKITAESV
FT                   CVHGDSPAAVDMAAAIRDLLESSDVEITPFT"
     MGYSVDLNSD LGEGFGAWTL GDDDAMLELV TSANIACGFH AGDPTTLLAT CESAATRGVR        60
     IGAQVGYRDL AGFGRRFIDM SPKDLTADVI YQIGALDGLA RVAGSRVTYV KPHGALYNAI       120
     VHHRRQARAV VAAVVAYDSS LPVLGLPGSV FLEEAREAGL DVVAEAFADR AYTAEGTLVP       180
     RTESGAVLND PALVAERVRR MVVDGELDAV DGSTLKITAE SVCVHGDSPA AVDMAAAIRD       240
     LLESSDVEIT PFT                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page