(data stored in ACNUC1104 zone)

EMBL: AP008957.PE71

AP008957.PE71        Location/Qualifiers
FT   CDS             complement(88616..91930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00710"
FT                   /product="probable lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="protein synonym:LysRS"
FT                   /note="protein synonym:lysine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00710"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30779"
FT                   /db_xref="GOA:C0ZL89"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="InterPro:IPR031553"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZL89"
FT                   /protein_id="BAH30779.1"
FT                   /translation="MESPPENPRQARRFRKGRFSQVPHISGLILGVFSVLVFLWSISPV
FT                   LRHILRVPREYIDSYYFDAPDTSLSWALVVALLAAALASRKRIAWWLLTIYLALITLTN
FT                   IASTIVDKNPNNAVAAVVLLVVIGILIAARPEFYTRVRRGAGWKALGVLIGGMAVATVI
FT                   GWGLVELFPGDLPQNQRFLWALNRVTAAASVDNEVFDGHPRVFVNTVLGLLGAIALLAA
FT                   VMTLFRAQRSNNALTGNDESAIRGLIQNFGADDSLAYFATRRDKAVIFAPSGKAAITYR
FT                   VEIGVCLASGDPIGDPEAWPHAIEAWQDLASQYGWATAVMGASETGATAYKKAGLSVLQ
FT                   LGDEAILRTREFNLNGRDMRPVRQAVTRVRRHGVTVRMRRHRDIPPEDMAAVIIRADDW
FT                   RDTDTERGFSMALGRLGDHLDGDCLLVEAVMGEGTEDESVVGMLSLVPWGPNGVSLDLM
FT                   RRKPTAPNGVVELMVSELATRSDEIGVVRVSLNFAVFRSVFEEGSRIGAGPILRIWRSV
FT                   LVFFSRWWQLEALYRSNVKYQPDWEPRFLCFEDNRELPRVGFASAIAEGFVVLPSFGRK
FT                   SSQVVKHTGTHAAVPAALVTSEGLHADGSPPDSAPSFTTNGPRRPEQVRVRMNKLAQLA
FT                   DEGIAAYPVAYPPTHTIAAAAKSPEGTRVRIAGRLLRVRDYGGVVFTDVRDWSGDIQVL
FT                   VDQDNVGREKLAEFAAEFDLGDLIEVSGTIGRSRKGELSLIAVEWRMNGKCLHPLPDKW
FT                   KGLSDPETRVRQRYLDIALNPKARELLEARSAVVKSLRDSLGGRGYLEVETPILQQVHG
FT                   GANAAPFLTHINAYNLDLYLRIAPELYLKRLCVAGMEKVFEIGRVFRNEGVDFKHNPEF
FT                   TILEAYEAHSDYEGMMRMCRELIQAAAVAAFGREIIMRPGPDGELVEVDISGEWPVKTM
FT                   HGAVAEKLGVDVSPETSLEDLQKLCDANEIPYQSSWDTGAIAQEMYEHLVEDYTEFPTF
FT                   YTNFPTSMSPLTRPHRSIPGVAEKWDLVAWGVELGTAYSELTDPVDQRNRLTEQSMLAA
FT                   GGDPEAMELDEDFLQALEHAMPPTGGLGMGVDRIVMLITGGSIRETLAFPLAKPRQ"
     MESPPENPRQ ARRFRKGRFS QVPHISGLIL GVFSVLVFLW SISPVLRHIL RVPREYIDSY        60
     YFDAPDTSLS WALVVALLAA ALASRKRIAW WLLTIYLALI TLTNIASTIV DKNPNNAVAA       120
     VVLLVVIGIL IAARPEFYTR VRRGAGWKAL GVLIGGMAVA TVIGWGLVEL FPGDLPQNQR       180
     FLWALNRVTA AASVDNEVFD GHPRVFVNTV LGLLGAIALL AAVMTLFRAQ RSNNALTGND       240
     ESAIRGLIQN FGADDSLAYF ATRRDKAVIF APSGKAAITY RVEIGVCLAS GDPIGDPEAW       300
     PHAIEAWQDL ASQYGWATAV MGASETGATA YKKAGLSVLQ LGDEAILRTR EFNLNGRDMR       360
     PVRQAVTRVR RHGVTVRMRR HRDIPPEDMA AVIIRADDWR DTDTERGFSM ALGRLGDHLD       420
     GDCLLVEAVM GEGTEDESVV GMLSLVPWGP NGVSLDLMRR KPTAPNGVVE LMVSELATRS       480
     DEIGVVRVSL NFAVFRSVFE EGSRIGAGPI LRIWRSVLVF FSRWWQLEAL YRSNVKYQPD       540
     WEPRFLCFED NRELPRVGFA SAIAEGFVVL PSFGRKSSQV VKHTGTHAAV PAALVTSEGL       600
     HADGSPPDSA PSFTTNGPRR PEQVRVRMNK LAQLADEGIA AYPVAYPPTH TIAAAAKSPE       660
     GTRVRIAGRL LRVRDYGGVV FTDVRDWSGD IQVLVDQDNV GREKLAEFAA EFDLGDLIEV       720
     SGTIGRSRKG ELSLIAVEWR MNGKCLHPLP DKWKGLSDPE TRVRQRYLDI ALNPKARELL       780
     EARSAVVKSL RDSLGGRGYL EVETPILQQV HGGANAAPFL THINAYNLDL YLRIAPELYL       840
     KRLCVAGMEK VFEIGRVFRN EGVDFKHNPE FTILEAYEAH SDYEGMMRMC RELIQAAAVA       900
     AFGREIIMRP GPDGELVEVD ISGEWPVKTM HGAVAEKLGV DVSPETSLED LQKLCDANEI       960
     PYQSSWDTGA IAQEMYEHLV EDYTEFPTFY TNFPTSMSPL TRPHRSIPGV AEKWDLVAWG      1020
     VELGTAYSEL TDPVDQRNRL TEQSMLAAGG DPEAMELDED FLQALEHAMP PTGGLGMGVD      1080
     RIVMLITGGS IRETLAFPLA KPRQ                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page