(data stored in ACNUC1104 zone)

EMBL: AP008957.PE74

AP008957.PE74        Location/Qualifiers
FT   CDS             92853..93839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30782"
FT                   /db_xref="InterPro:IPR011200"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL92"
FT                   /protein_id="BAH30782.1"
FT                   /translation="MDTSRWYRSFAEVEARGNSEVYEEWGNGVSEDPAVLALIDRLPEP
FT                   RRQPNLIFGASRHLGAPVAPYASFRRWLRENWSAVEQLARIRTTQTNEAGRAAVLLPVL
FT                   GLLKGPLSLIEVGASAGLCLYPDRYSFLYDGTKYLHPVDGPSTVLLECATTGSPPIPER
FT                   VPDVVYRAGIDLNPLDVGDTDDMRWLESLVWPEQDHRRQRLRDAAALARVDPPHLVRGD
FT                   LTAAVADLVRRAPQNTTVVVYHSAVLNYLTLTAREEFAETVRALPCHWIANEGLGVLPE
FT                   VDAKLTASPEARRGKFVVSLDGTPRGLAGGHGQSLDWLDQTRTAPAG"
     MDTSRWYRSF AEVEARGNSE VYEEWGNGVS EDPAVLALID RLPEPRRQPN LIFGASRHLG        60
     APVAPYASFR RWLRENWSAV EQLARIRTTQ TNEAGRAAVL LPVLGLLKGP LSLIEVGASA       120
     GLCLYPDRYS FLYDGTKYLH PVDGPSTVLL ECATTGSPPI PERVPDVVYR AGIDLNPLDV       180
     GDTDDMRWLE SLVWPEQDHR RQRLRDAAAL ARVDPPHLVR GDLTAAVADL VRRAPQNTTV       240
     VVYHSAVLNY LTLTAREEFA ETVRALPCHW IANEGLGVLP EVDAKLTASP EARRGKFVVS       300
     LDGTPRGLAG GHGQSLDWLD QTRTAPAG                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page