(data stored in ACNUC1104 zone)

EMBL: AP008957.PE76

AP008957.PE76        Location/Qualifiers
FT   CDS             94581..95804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30784"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL94"
FT                   /protein_id="BAH30784.1"
FT                   /translation="MNLRTETETSGGDPDYAEFARPGESRNDPAEMRRSLEGWLTTVLW
FT                   RGSKPSVTSVEVPAANGMSNETVLFDATWIEDGIRAEHRLVARIAPRDSAVPIFPSYNL
FT                   DQQFRVMSAVAAHTSVPIPRVYWSESNPDALGGEFFVMERREGEIPPDVMPYTFGSWLS
FT                   EASADDCSRLQQSSVRVLTELHTMADPHLALPELCRDGTEPTGAEALRAHLEDQRRYYE
FT                   WATADGPGSPLIERGFDWIEANFPVDAGSAVLCWGDSRIGNVIYRDFEPAAVLDWEMAT
FT                   LGPRELDLGWMIFQHRFFEDLAAMAGLPGMPDFLRREDVAEAYRSLSGHEVADLDFYIV
FT                   YAALRHAVIMFRVQSRAVAFGQAELPDNPDEMILHHKTLEAMLDGTYWESLATATLTTA
FT                   SVATGDAR"
     MNLRTETETS GGDPDYAEFA RPGESRNDPA EMRRSLEGWL TTVLWRGSKP SVTSVEVPAA        60
     NGMSNETVLF DATWIEDGIR AEHRLVARIA PRDSAVPIFP SYNLDQQFRV MSAVAAHTSV       120
     PIPRVYWSES NPDALGGEFF VMERREGEIP PDVMPYTFGS WLSEASADDC SRLQQSSVRV       180
     LTELHTMADP HLALPELCRD GTEPTGAEAL RAHLEDQRRY YEWATADGPG SPLIERGFDW       240
     IEANFPVDAG SAVLCWGDSR IGNVIYRDFE PAAVLDWEMA TLGPRELDLG WMIFQHRFFE       300
     DLAAMAGLPG MPDFLRREDV AEAYRSLSGH EVADLDFYIV YAALRHAVIM FRVQSRAVAF       360
     GQAELPDNPD EMILHHKTLE AMLDGTYWES LATATLTTAS VATGDAR                     407
//

If you have problems or comments...

PBIL Back to PBIL home page