(data stored in ACNUC1104 zone)

EMBL: AP008957.PE79

AP008957.PE79        Location/Qualifiers
FT   CDS             complement(97962..98537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00790"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00790"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30787"
FT                   /db_xref="GOA:C0ZL97"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL97"
FT                   /protein_id="BAH30787.1"
FT                   /translation="MTDDDPTTERGGPASWWKVTAIVAAVLVALTCGVIVWSFMPPVVY
FT                   FPFFALAASVLLGLGGVWLILSLIGWMKYKTLRLSTIAPVIVLVTGALVTLSVPSRVAF
FT                   ALSKDSLEAVAADCQKSLDNQTIGVYRVLQVWPVGNGCRFHIEGGLIDSIGLAYLPDGA
FT                   PYLGKPRRDGEIGYQEFDGDWYSFVQAF"
     MTDDDPTTER GGPASWWKVT AIVAAVLVAL TCGVIVWSFM PPVVYFPFFA LAASVLLGLG        60
     GVWLILSLIG WMKYKTLRLS TIAPVIVLVT GALVTLSVPS RVAFALSKDS LEAVAADCQK       120
     SLDNQTIGVY RVLQVWPVGN GCRFHIEGGL IDSIGLAYLP DGAPYLGKPR RDGEIGYQEF       180
     DGDWYSFVQA F                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page