(data stored in ACNUC1104 zone)

EMBL: AP008957.PE80

AP008957.PE80        Location/Qualifiers
FT   CDS             98688..99152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00800"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30788"
FT                   /db_xref="GOA:C0ZL98"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZL98"
FT                   /protein_id="BAH30788.1"
FT                   /translation="MNQDLIIRRYRPSDEDVVVDLWSRAAREAHPFLTGEGTGEREQKM
FT                   REVYLIQADNWVAEHNSEVVGLLGMIGSEIGGLFVAPASQGLGVGRALVEHATTMHGEV
FT                   TLEVYTLNDRARRFYALMDFEEEGRRHDAETNHELITLRRTGRDSSLIQA"
     MNQDLIIRRY RPSDEDVVVD LWSRAAREAH PFLTGEGTGE REQKMREVYL IQADNWVAEH        60
     NSEVVGLLGM IGSEIGGLFV APASQGLGVG RALVEHATTM HGEVTLEVYT LNDRARRFYA       120
     LMDFEEEGRR HDAETNHELI TLRRTGRDSS LIQA                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page