(data stored in ACNUC1104 zone)

EMBL: AP008957.PE83

AP008957.PE83        Location/Qualifiers
FT   CDS             100979..101398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00830"
FT                   /product="putative Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00830"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30791"
FT                   /db_xref="GOA:C0ZLA1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA1"
FT                   /protein_id="BAH30791.1"
FT                   /translation="MKAYFRDGKGGDVNGSSARQLMSQMLVEKRNSLAPEMVGMRCEGA
FT                   RRMHGLSRRDVAQIADISFNHYQRLEQGTSVGVSAPVIVRICDALLMEDDEKARMLALH
FT                   QAWARPRRPLAGSRVAGPQAAGEISGRQRASSSGV"
     MKAYFRDGKG GDVNGSSARQ LMSQMLVEKR NSLAPEMVGM RCEGARRMHG LSRRDVAQIA        60
     DISFNHYQRL EQGTSVGVSA PVIVRICDAL LMEDDEKARM LALHQAWARP RRPLAGSRVA       120
     GPQAAGEISG RQRASSSGV                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page