(data stored in ACNUC1104 zone)

EMBL: AP008957.PE84

AP008957.PE84        Location/Qualifiers
FT   CDS             complement(101344..102771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00840"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30792"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA2"
FT                   /protein_id="BAH30792.1"
FT                   /translation="MLAAAGAVGLVLVTSSVQSIATASPFGSLDAGSSSGSTEIPTVSN
FT                   GGFTSKTPYTPGQRIADYQAPPTGYIPVYTESVARHGSRALSSLKYDDLSLQLWEIAEA
FT                   ENALTPVGKEFGPALRDLMAANKKLGYGNLSGLGVTEHRQLGARVTERLPQLFDAIAAQ
FT                   QGTITLTSSGVDRAVDSAENFAQGLTGAFPAVAGDVAPVTTDADLLYFHDSDANADYKD
FT                   YEESDPRLKAVDDQIADLPRTREVSRHMMLRLYSEDFVNRLSAGEFSLVDRGKGSSTID
FT                   NEVDAAYMLYNTYIITPGMAEEGKWNFERFIDSDDAQWLAYTNDAEDFYAKGPGFTGED
FT                   VTYRMATVLRDEFLRGLQEHTGDAAVPGADFRFAHAETIIPFAALLKLPGSTVSQAEGD
FT                   LYTYANNPWRGANVSPMAANVQWDVYAGPDGERLVRMLYNERETAFAAPCAPVSAGSFF
FT                   YTPDELARCLPEISPAA"
     MLAAAGAVGL VLVTSSVQSI ATASPFGSLD AGSSSGSTEI PTVSNGGFTS KTPYTPGQRI        60
     ADYQAPPTGY IPVYTESVAR HGSRALSSLK YDDLSLQLWE IAEAENALTP VGKEFGPALR       120
     DLMAANKKLG YGNLSGLGVT EHRQLGARVT ERLPQLFDAI AAQQGTITLT SSGVDRAVDS       180
     AENFAQGLTG AFPAVAGDVA PVTTDADLLY FHDSDANADY KDYEESDPRL KAVDDQIADL       240
     PRTREVSRHM MLRLYSEDFV NRLSAGEFSL VDRGKGSSTI DNEVDAAYML YNTYIITPGM       300
     AEEGKWNFER FIDSDDAQWL AYTNDAEDFY AKGPGFTGED VTYRMATVLR DEFLRGLQEH       360
     TGDAAVPGAD FRFAHAETII PFAALLKLPG STVSQAEGDL YTYANNPWRG ANVSPMAANV       420
     QWDVYAGPDG ERLVRMLYNE RETAFAAPCA PVSAGSFFYT PDELARCLPE ISPAA            475
//

If you have problems or comments...

PBIL Back to PBIL home page