(data stored in ACNUC1104 zone)

EMBL: AP008957.PE89

AP008957.PE89        Location/Qualifiers
FT   CDS             complement(108594..108971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30797"
FT                   /db_xref="GOA:C0ZLA7"
FT                   /db_xref="InterPro:IPR035197"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLA7"
FT                   /protein_id="BAH30797.1"
FT                   /translation="MAEQTRPNFPQYCGYLLGKTLPDRYQDWVRNDLVGPGAQARYIIR
FT                   FTVPATLILLLFLLIPGPIWIPLAMMALLLIPLAYFVVALGTIYRRHRLLSHGLDPELL
FT                   DEKAQRRADRTREDYEKRHGR"
     MAEQTRPNFP QYCGYLLGKT LPDRYQDWVR NDLVGPGAQA RYIIRFTVPA TLILLLFLLI        60
     PGPIWIPLAM MALLLIPLAY FVVALGTIYR RHRLLSHGLD PELLDEKAQR RADRTREDYE       120
     KRHGR                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page