(data stored in ACNUC1104 zone)

EMBL: AP008957.PE99

AP008957.PE99        Location/Qualifiers
FT   CDS             complement(117916..119118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RER_00990"
FT                   /product="probable two-component histidine kinase"
FT                   /EC_number="2.7.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30807"
FT                   /db_xref="GOA:C0ZLB7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017205"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLB7"
FT                   /protein_id="BAH30807.1"
FT                   /translation="MDEPGPNLAKLGEMHRSPLTPVFAGLQLGLHVLVMALAGVVFLRA
FT                   LIDESDLTATIIALAVIFVAVYLFGVAKRLRGNAARWWLAVLTLVWIATMAVSADAAYL
FT                   AFGLFFLYLHILRRPWSLLAVTAATAVAVIGTGLHRGWTVAGAVGPIIGAAVAVAIGLG
FT                   YQALYREAAERGRLIDELMNTREELASTSRDAGKFAERERLAAEIHDTVAQGLSSIQML
FT                   LHAAERADPESPAIRQISLARETAADSLAETRQLIAELTPAALDGQSLADALRRICERA
FT                   SSPELEARSVVEGEALRLPMPLEATLVRIAQGAVSNVLRHADATRMAVTLTYSDNTVSL
FT                   DVVDNGRGFDVAVLERGPAESFGLNAIRRRVELQGGTFSIESEPGHTAVAVTFPLDVGE
FT                   Q"
     MDEPGPNLAK LGEMHRSPLT PVFAGLQLGL HVLVMALAGV VFLRALIDES DLTATIIALA        60
     VIFVAVYLFG VAKRLRGNAA RWWLAVLTLV WIATMAVSAD AAYLAFGLFF LYLHILRRPW       120
     SLLAVTAATA VAVIGTGLHR GWTVAGAVGP IIGAAVAVAI GLGYQALYRE AAERGRLIDE       180
     LMNTREELAS TSRDAGKFAE RERLAAEIHD TVAQGLSSIQ MLLHAAERAD PESPAIRQIS       240
     LARETAADSL AETRQLIAEL TPAALDGQSL ADALRRICER ASSPELEARS VVEGEALRLP       300
     MPLEATLVRI AQGAVSNVLR HADATRMAVT LTYSDNTVSL DVVDNGRGFD VAVLERGPAE       360
     SFGLNAIRRR VELQGGTFSI ESEPGHTAVA VTFPLDVGEQ                             400
//

If you have problems or comments...

PBIL Back to PBIL home page