(data stored in ACNUC1104 zone)

EMBL: AP008957.PKNA

AP008957.PKNA        Location/Qualifiers
FT   CDS             complement(34073..35431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pknA"
FT                   /locus_tag="RER_00290"
FT                   /product="probable serine/threonine protein kinase PknA"
FT                   /EC_number="2.7.11.1"
FT                   /note="protein synonym:protein kinase A"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30737"
FT                   /db_xref="GOA:C0ZLG9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLG9"
FT                   /protein_id="BAH30737.1"
FT                   /translation="MALNNGALIADRYRLIRLIATGGMGQVWEATDSRLNRRVAVKVLK
FT                   SEFSSDPEFLERFRFEARTTAQLNHPGIAGIYDYGETRDSSGDSTAYLVMELVNGEPLN
FT                   AVLARVGRLAVPHALDMLEQTGRALQVAHDAGVVHRDVKPGNILITPTGQVKITDFGIA
FT                   KAVENSPVTRTGMVMGTAQYIAPEQALGQDATAASDVYSLGIVGYEALSGRRPFTGDGA
FT                   LTVAMKHVQETPAPMPADLPANIRELIDITLTKDPAGRYASGGEFADAVAAVRAGRRPP
FT                   PPGLLATGAASALPATGATQVMPPTYAGPVTGAAVADDAAAGGMTSGQKAVAWAGGGLI
FT                   LLALIIGGVWIATDGPSDPTPPVVTSTTLPTTTTTKPTTTTTRPTTTTTEPTTTTTRPT
FT                   TTTTEPTTTTTTPTTTTTTPTTTTTTTTTTTTTTTTEPLADPGDAEEPLGQDQ"
     MALNNGALIA DRYRLIRLIA TGGMGQVWEA TDSRLNRRVA VKVLKSEFSS DPEFLERFRF        60
     EARTTAQLNH PGIAGIYDYG ETRDSSGDST AYLVMELVNG EPLNAVLARV GRLAVPHALD       120
     MLEQTGRALQ VAHDAGVVHR DVKPGNILIT PTGQVKITDF GIAKAVENSP VTRTGMVMGT       180
     AQYIAPEQAL GQDATAASDV YSLGIVGYEA LSGRRPFTGD GALTVAMKHV QETPAPMPAD       240
     LPANIRELID ITLTKDPAGR YASGGEFADA VAAVRAGRRP PPPGLLATGA ASALPATGAT       300
     QVMPPTYAGP VTGAAVADDA AAGGMTSGQK AVAWAGGGLI LLALIIGGVW IATDGPSDPT       360
     PPVVTSTTLP TTTTTKPTTT TTRPTTTTTE PTTTTTRPTT TTTEPTTTTT TPTTTTTTPT       420
     TTTTTTTTTT TTTTTEPLAD PGDAEEPLGQ DQ                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page