(data stored in ACNUC1104 zone)

EMBL: AP008957.QOR

AP008957.QOR         Location/Qualifiers
FT   CDS             407180..408154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor"
FT                   /locus_tag="RER_03680"
FT                   /product="probable NADPH--quinone reductase"
FT                   /EC_number="1.6.5.5"
FT                   /note="protein synonym:quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_03680"
FT                   /db_xref="EnsemblGenomes-Tr:BAH31076"
FT                   /db_xref="GOA:C0ZN24"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZN24"
FT                   /protein_id="BAH31076.1"
FT                   /translation="MANAIRFHEIGTPSVMRWEEIEVGRPGAGEVRVRHEAVGLNFADT
FT                   YFRSGLYPAQLPAGMGVEGAGVVEEIGEGVVDFAVGDRVTYTGSPLGAYATERIMASSD
FT                   LIALPDGIAFDTAAAMTMRGLTAAYLLRRIYPLKAGDTVLLHAAAGGVGLIFTQWAKLL
FT                   GIKVIGTVSSDEKASVARAHGCDEVVIYTREDVVARVKEITGGVGVPVVYDSIGQSTFD
FT                   ISLDCLARRGLLVCFGTASGPTPPIQAMQLAVKGSLFLTRPALADYIADPEERAELAGE
FT                   LFSHVESGRIKIEINQRYPLEDAVRAHHDMESGRSIGSSVFSV"
     MANAIRFHEI GTPSVMRWEE IEVGRPGAGE VRVRHEAVGL NFADTYFRSG LYPAQLPAGM        60
     GVEGAGVVEE IGEGVVDFAV GDRVTYTGSP LGAYATERIM ASSDLIALPD GIAFDTAAAM       120
     TMRGLTAAYL LRRIYPLKAG DTVLLHAAAG GVGLIFTQWA KLLGIKVIGT VSSDEKASVA       180
     RAHGCDEVVI YTREDVVARV KEITGGVGVP VVYDSIGQST FDISLDCLAR RGLLVCFGTA       240
     SGPTPPIQAM QLAVKGSLFL TRPALADYIA DPEERAELAG ELFSHVESGR IKIEINQRYP       300
     LEDAVRAHHD MESGRSIGSS VFSV                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page