(data stored in ACNUC1104 zone)

EMBL: AP008957.RECF

AP008957.RECF        Location/Qualifiers
FT   CDS             5054..6283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="RER_00040"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:RER_00040"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30712"
FT                   /db_xref="GOA:C0ZLE4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0ZLE4"
FT                   /protein_id="BAH30712.1"
FT                   /translation="MFVRRFSLRDFRSWDSLTLDLTPGTTVFLGSNGHGKTNVLESLGY
FT                   LSTLSSHRVSTDAPMIRSGSASAFAGATVVNNGRELTIDVELIEGKSNRARINQSPTRR
FT                   PREVLGILQSVMFAPEDLSLVRGDPGDRRRYLDELLTSRIPRMAAVRADYDKVLRQRSA
FT                   LLKTAGAALRRGSRGGESDNVLSTLEVWDGHLAAHGAQLLAGRLELVHDLAPHLAESYR
FT                   SIAPESRPASIRYKSSLGSSLDPEFTDPARISGIDDVAYLEERFHLELAQMRSKEIDRG
FT                   VCLVGPHRDDLELVLGDSPAKGFASHGESWSFALSLRLAGFALLRADGSDPVLMLDDVF
FT                   AELDRRRRRALATVAATAEQVLITAAVPEDVPDELEAAKFGVEASDTGDGRISRIVPVG
FT                   STDQEVEFDD"
     MFVRRFSLRD FRSWDSLTLD LTPGTTVFLG SNGHGKTNVL ESLGYLSTLS SHRVSTDAPM        60
     IRSGSASAFA GATVVNNGRE LTIDVELIEG KSNRARINQS PTRRPREVLG ILQSVMFAPE       120
     DLSLVRGDPG DRRRYLDELL TSRIPRMAAV RADYDKVLRQ RSALLKTAGA ALRRGSRGGE       180
     SDNVLSTLEV WDGHLAAHGA QLLAGRLELV HDLAPHLAES YRSIAPESRP ASIRYKSSLG       240
     SSLDPEFTDP ARISGIDDVA YLEERFHLEL AQMRSKEIDR GVCLVGPHRD DLELVLGDSP       300
     AKGFASHGES WSFALSLRLA GFALLRADGS DPVLMLDDVF AELDRRRRRA LATVAATAEQ       360
     VLITAAVPED VPDELEAAKF GVEASDTGDG RISRIVPVGS TDQEVEFDD                   409
//

If you have problems or comments...

PBIL Back to PBIL home page