(data stored in ACNUC1104 zone)

EMBL: AP008957.SERS

AP008957.SERS        Location/Qualifiers
FT   CDS             216186..217439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="RER_01960"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="protein synonym:SerRS"
FT                   /note="protein synonym:serine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:RER_01960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH30904"
FT                   /db_xref="GOA:C0ZLS7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C0ZLS7"
FT                   /protein_id="BAH30904.1"
FT                   /translation="MIDLKFLRENPEIVRESQRTRGEDPGLVDALLEADASRRAAVLTG
FT                   DNLRAEQKAFGKKVGQASPEERPALLEGSKELAAKVKEAEAAQHEAQAALDAAHRAISN
FT                   VVQEGAPAGGEDDYIVLEHVGEIPKFDFEPKDHLELGESLGLIDMERGAKVSGSRFYFM
FT                   TGYGAMLQLGLLQLAAQKAIANGFTMMIPPVLVRPEIMAGTGFLGAHSDEIYHLQDDDL
FT                   YLVGTSEVPMAGYHSGEILELNEGPKRYAGWSSCFRREAGSYGKDTRGIIRVHQFDKVE
FT                   MFTYCRPEDADAEHQRLLGWERDMLAAIDVPYRVIDVAGGDLGSSAARKFDCEAWVPTQ
FT                   GTYRELTSTSNCTTFQARRLGVRYRDENGKPQTAATLNGTLATTRWIVSILENHQQADG
FT                   SVRVPEALVPFVGTDVLR"
     MIDLKFLREN PEIVRESQRT RGEDPGLVDA LLEADASRRA AVLTGDNLRA EQKAFGKKVG        60
     QASPEERPAL LEGSKELAAK VKEAEAAQHE AQAALDAAHR AISNVVQEGA PAGGEDDYIV       120
     LEHVGEIPKF DFEPKDHLEL GESLGLIDME RGAKVSGSRF YFMTGYGAML QLGLLQLAAQ       180
     KAIANGFTMM IPPVLVRPEI MAGTGFLGAH SDEIYHLQDD DLYLVGTSEV PMAGYHSGEI       240
     LELNEGPKRY AGWSSCFRRE AGSYGKDTRG IIRVHQFDKV EMFTYCRPED ADAEHQRLLG       300
     WERDMLAAID VPYRVIDVAG GDLGSSAARK FDCEAWVPTQ GTYRELTSTS NCTTFQARRL       360
     GVRYRDENGK PQTAATLNGT LATTRWIVSI LENHQQADGS VRVPEALVPF VGTDVLR          417
//

If you have problems or comments...

PBIL Back to PBIL home page